The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016]

Immunostaining procedure conditions:           

Antigen retrieval with Target Retrieval Solution, pH9 (Agilent Technologies, Cat. #S2367) for 40 minutes at 95°C.

Primary and secondary incubations performed using the following reagents:

Antibody charactierzation and validation (SLC9a3):

This commercial rabbit polyclonal antibody from Novus Biologicals* (NBP1-82574) was “raised against recombinant protein corresponding to amino acids DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST. Antibodies are immunogen affinity purified. For further validation, the company performed orthogonal validation in IHC that compared IHC stains to the RNA-Seq data of samples of positive and negative (or low) expression samples. In formalin-fixed paraffin-embedded tissue, the antibody recognizes both human and mouse. In human formalin-fixed, paraffin, embedded tissue, localization on the apical surface of the villus of the small intestine (right, upper image) as well as in colon (right, lower image) was confirmed.